PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_008766-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family MYB
Protein Properties Length: 327aa    MW: 36892.7 Da    PI: 4.6389
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_008766-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding44.53.5e-141257146
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                     +g+W +eEde+l+d+vk++G+++W++I ++  + Rt+k+c++rw +
    NNU_008766-RA 12 KGPWMAEEDEILLDYVKKYGPRDWSSIRSKGLLPRTGKSCRLRWVN 57
                     79*************************8876677**********87 PP

2Myb_DNA-binding41.62.9e-1368108345
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      +++ eE+   +d+ +++G++ W++Ia +++ gRt++++k++w 
    NNU_008766-RA  68 KFSVEEERVVIDLQAKFGNK-WARIATYLP-GRTDNDVKNFWS 108
                      799*****************.*********.***********5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.796159IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.8E-201060IPR009057Homeodomain-like
SuperFamilySSF466897.03E-2811107IPR009057Homeodomain-like
SMARTSM007172.3E-121161IPR001005SANT/Myb domain
PfamPF002494.4E-121257IPR001005SANT/Myb domain
CDDcd001671.33E-121459No hitNo description
PROSITE profilePS5129420.38860115IPR017930Myb domain
Gene3DG3DSA:1.10.10.608.4E-1861113IPR009057Homeodomain-like
SMARTSM007178.1E-1265113IPR001005SANT/Myb domain
PfamPF002491.3E-1168108IPR001005SANT/Myb domain
CDDcd001673.38E-1068107No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 327 aa     Download sequence    Send to blast
MEGKKDEVVM RKGPWMAEED EILLDYVKKY GPRDWSSIRS KGLLPRTGKS CRLRWVNKLK  60
PDLKTGCKFS VEEERVVIDL QAKFGNKWAR IATYLPGRTD NDVKNFWSTR QKRLARILQT  120
SQPCKSQKNN GKSSVLHEIP PLEFAEPVIV ASDLFQAPKF SSTSVEEVSS SSSSKDQNFP  180
PSYMENSEVI KMVPLPDLVN PNLLNLGTNN LTQLEYTPME KKPCVDPLSQ FPFPQLPQPP  240
LDLPLPLLPE SQELADTNLL NVFSRQMASE PDEDGPQLPL GLLSFGSEVN SQNSGRGDDN  300
PAMPDSYFDD FPTDMFDYLE QFPSSSE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C5e-281011325126MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010259182.10.0PREDICTED: myb-related protein 305-like
TrEMBLD7SLV61e-112D7SLV6_VITVI; Putative uncharacterized protein
STRINGVIT_15s0021g02040.t011e-111(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G60460.15e-67MYB family protein